This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.
Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.
Search results
From Proteopedia
You searched for Michael_Strong/H1N1/HA/MSA
There is no page with the exact title "Michael_Strong/H1N1/HA/MSA". The search results for "Michael_Strong/H1N1/HA/MSA" are displayed below. You can create a page titled Michael_Strong/H1N1/HA/MSA (by clicking on the red link).
For more information about searching Proteopedia, see Help.
Showing below 15 results starting with #1.
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
No page title matches
Page text matches
- Proteopedia:Page of the Year Entrants (2,819 bytes)
12: ...]] [[User:Mette Trauelsen]] -- [[Nitric Oxide Synthase]]
17: # [[User:Tzviya Zeev-Ben-Mordehai]] -- [[Intrinsically Disordered Protein]] (see h...
18: ...ilman Schirmer]] -- [[C-di-GMP signaling]] (Note that there are several sub-pages)
21: ...ee Mukherjee]] -- [[PHB synthase in Rhodobacter sphaeroides]]
22: # [[User:Paula Grabowski]] -- [[Triosephosphate Isomerase]] - User:Michael Strong (964 bytes)
1: Michael Strong<br>
9: '''H1N1 Swine Flu Genome and Protein Analysis:'''
10: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
16: [[User:Michael_Strong/TB|M. tuberculosis Drug Resistance Mutat... - Avian Influenza Neuraminidase, Tamiflu and Relenza (20,727 bytes)
9: ...g them to enter and infect cells. After the virus has replicated, neuraminidase (also called sialidase...
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
18: *Each of the four protein chains in the tetramer has a catalytic site, indicated in <scene name='Avia...
20: ...le protein chain, being distant from neighboring chains.
22: ...isting of several beta sheets with three short alpha helices ({{Template:ColorKey_Strand}}, {{Template... - User:Michael Strong/H1N1 (61,695 bytes)
1: '''2009 H1N1 swine flu genome and protein analysis'''
3: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
6: ...ng Multiple Sequence Alignments of newly sequence H1N1 strains, Sequence Polymorphisms, and Related Sequ...
8: ...B1, PA, HA, NP, NA, MP, and NS proteins from 2009 H1N1 strains from Mexico, California, Texas, New York,...
12: .../3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' /> - User:Michael Strong/H1N1/PB2 (362,698 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: .../3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' />
64: |<scene name='User:Michael_Strong/H1N1/PB2/MSA/2/1'>G698</scene>
70: H1N1 Swine Flu Multiple Sequence Alignment of PB2 Prot...
172: gi|229892698_A/Canada-NS/RV153 HADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAP 2... - User:Michael Strong/H1N1/PB1 (389,962 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
70: H1N1 Swine Flu Multiple Sequence Alignment of PB1 Prot...
732: ...823_1 PB1 [Influenza A virus (A/Wisconsin/10/98 (H1N1))]
1520: ...ase PB1 [Influenza A virus (A/swine/Ohio/75004/04(H1N1))]
1748: ...4969.1| polymerase PB1 [Influenza A virus (A/Nanchang/0074/94(H3N2))] - User:Michael Strong/H1N1/PA (354,535 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/3cm8 3cm8]' scene ='User:Michael_Strong/H1N1/PA/MSA/1/1'/>
24: |<scene name='User:Michael_Strong/H1N1/PA/MSA/269/2'>269</scene>
30: |<scene name='User:Michael_Strong/H1N1/PA/MSA/275/3'>275</scene>
36: |<scene name='User:Michael_Strong/H1N1/PA/MSA/581/2'>581</scene> - User:Michael Strong/H1N1/HA (303,506 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/3gbn 3gbn]' scene ='User:Michael_Strong/H1N1/HA/MSA/1/1'/>
15: |HA
20: |HA
25: |HA - User:Michael Strong/H1N1/NP (283,820 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/2q06 2q06]' scene ='User:Michael_Strong/H1N1/NP/MSA/1/1'/>
24: |<scene name='User:Michael_Strong/H1N1/NP/MSA/35/1'>35</scene>
30: |<scene name='User:Michael_Strong/H1N1/NP/MSA/90/1'>90</scene>
36: |<scene name='User:Michael_Strong/H1N1/NP/MSA/106/1'>106</scene> - Influenza (3,024 bytes)
1: ...H1N1_navbox.jpg|350px|right|thumb| Picture of the H1N1 Influenza Virus]]
8: * H1N1 Sequence Analyses
9: ** [[User:Michael_Strong/H1N1|H1N1 Swine Flu Sequence Analysis]]
10: ** [[User:Michael_Strong/H1N1/MP1/MSA|H1N1 Swine Flu Multiple Sequence Alignment]]
11: ** [[User:Michael Strong/H1N1/MP2/MSA|H1N1 Sequence Alignment of MP2 Protein]] - User:Michael Strong/H1N1/NA (258,192 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/3b7e 3b7e]' scene ='User:Michael_Strong/H1N1/NA/MSA/1/1'/>
29: |<scene name='User:Michael_Strong/H1N1/NA/MSA/83/1'>83</scene>
35: |<scene name='User:Michael_Strong/H1N1/NA/MSA/95/2'>95</scene>
41: |<scene name='User:Michael_Strong/H1N1/NA/MSA/96/2'>96</scene> - User:Michael Strong/H1N1/MP (265,936 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/2rlf 2rlf]' scene ='User:Michael_Strong/H1N1/MP/1/2'/>
19: |<scene name='User:Michael_Strong/H1N1/MP/3/2'>3</scene>
34: H1N1 Swine Flu Multiple Sequence Alignment of MP1 Prot...
301: gi|227831794_A/Texas/05/2009 EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR 248 - User:Michael Strong/H1N1/NS (152,680 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: .../3f5t 3f5t]' scene ='User:Michael_Strong/H1N1/NS1/MSA/1/1'/>
18: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/12/1'>12</scene>
24: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/32/1'>32</scene>
30: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/45/1'>45</scene> - User:Jaime Prilusky/Workbench/POTY2010 (4,243 bytes)
1: <!-- Please note that all contributions to Proteopedia are considered ...
2: You are also promising us that you wrote this yourself, or copied it from a pub...
29: ...[User:Daniel Seeman]] -- [[Alpha-1-antitrypsin]] (has an NMR format pdb in it, takes a while to load)
40: * [[User:Michael Strong]] -- [[2g38]] 0
51: ... [[User:Michael Strong]] -- [[User:Michael_Strong/H1N1]] - Sandbox hemant (20,243 bytes)
9: ...g them to enter and infect cells. After the virus has replicated, neuraminidase (also called sialidase...
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
18: *Each of the four protein chains in the tetramer has a catalytic site, indicated in <scene name='Avia...
20: ...le protein chain, being distant from neighboring chains.
22: ...isting of several beta sheets with three short alpha helices ({{Template:ColorKey_Strand}}, {{Template...
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
You may also try
