Search results
From Proteopedia
You searched for Michael_Strong/H1N1/MP
There is no page with the exact title "Michael_Strong/H1N1/MP". The search results for "Michael_Strong/H1N1/MP" are displayed below. You can create a page titled Michael_Strong/H1N1/MP (by clicking on the red link).
For more information about searching Proteopedia, see Help.
Showing below 15 results starting with #1.
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
No page title matches
Page text matches
- Proteopedia:Page of the Year Entrants (2,819 bytes)
1: ...ear Competition| Proteopedia's Page of the Year Competition]] here. You can enter as many pages as yo...
2: ... then a link to the page you're entering in the competition.
8: ...just an example, Eran cannot participate in the competition.
18: # [[User:Tilman Schirmer]] -- [[C-di-GMP signaling]] (Note that there are several sub-page...
27: ...ukrishna]] -- [[E.COLI OMPC - CAMEL LACTOFERRIN COMPLEX]] - User:Michael Strong (964 bytes)
9: '''H1N1 Swine Flu Genome and Protein Analysis:'''
10: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
13: [[2g38|M. tuberculosis PE/PPE protein complex]] <font color="blue"></font>
16: [[User:Michael_Strong/TB|M. tuberculosis Drug Resistance Mutations]] <f... - Avian Influenza Neuraminidase, Tamiflu and Relenza (20,727 bytes)
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
22: ... alpha helices ({{Template:ColorKey_Strand}}, {{Template:ColorKey_Helix}}).
25: <center>{{Template:ColorKey_ConSurf}}</center>
27: ...Element_C}}, {{Template:ColorKey_Element_O}}, {{Template:ColorKey_Element_N}}.
37: For the meaning of &quot;H1N1&quot;, &quot;H2N2&quot;, etc. see [[#Influenza Vi... - User:Michael Strong/H1N1 (61,695 bytes)
1: '''2009 H1N1 swine flu genome and protein analysis'''
3: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
6: ...ng Multiple Sequence Alignments of newly sequence H1N1 strains, Sequence Polymorphisms, and Related Sequ...
8: ...B1, PA, HA, NP, NA, MP, and NS proteins from 2009 H1N1 strains from Mexico, California, Texas, New York,...
12: ...index.php/3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' /> - User:Michael Strong/H1N1/PB2 (362,698 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' />
64: |<scene name='User:Michael_Strong/H1N1/PB2/MSA/2/1'>G698</scene>
70: H1N1 Swine Flu Multiple Sequence Alignment of PB2 Prot...
397: gi|229892692_A/Mexico/InDRE411 IESIDNVMGMIGIMPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500 - User:Michael Strong/H1N1/PB1 (389,962 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
70: H1N1 Swine Flu Multiple Sequence Alignment of PB1 Prot...
565: ... IRNLHIPEVCLKWELMDDDYRGRLCNPLNPFVSHKEIDSVNNAVVMPAHG 650
566: ... IRNLHIPEVCLKWELMDDDYRGRLCNPLNPFVSHKEIDSVNNAVVMPAHG 650
567: ... IRNLHIPEVCLKWELMDDDYRGRLCNPLNPFVSHKEIDSVNNAVVMPAHG 650 - User:Michael Strong/H1N1/PA (354,535 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/3cm8 3cm8]' scene ='User:Michael_Strong/H1N1/PA/MSA/1/1'/>
24: |<scene name='User:Michael_Strong/H1N1/PA/MSA/269/2'>269</scene>
30: |<scene name='User:Michael_Strong/H1N1/PA/MSA/275/3'>275</scene>
36: |<scene name='User:Michael_Strong/H1N1/PA/MSA/581/2'>581</scene> - User:Michael Strong/H1N1/HA (303,506 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/3gbn 3gbn]' scene ='User:Michael_Strong/H1N1/HA/MSA/1/1'/>
34: |<scene name='User:Michael_Strong/H1N1/HA/MSA/48/1'>48</scene>
40: |<scene name='User:Michael_Strong/H1N1/HA/MSA/49/1'>49</scene>
46: |<scene name='User:Michael_Strong/H1N1/HA/MSA/96/1'>96</scene> - User:Michael Strong/H1N1/NP (283,820 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/2q06 2q06]' scene ='User:Michael_Strong/H1N1/NP/MSA/1/1'/>
24: |<scene name='User:Michael_Strong/H1N1/NP/MSA/35/1'>35</scene>
30: |<scene name='User:Michael_Strong/H1N1/NP/MSA/90/1'>90</scene>
36: |<scene name='User:Michael_Strong/H1N1/NP/MSA/106/1'>106</scene> - Influenza (3,024 bytes)
1: ...H1N1_navbox.jpg|350px|right|thumb| Picture of the H1N1 Influenza Virus]]
8: * H1N1 Sequence Analyses
9: ** [[User:Michael_Strong/H1N1|H1N1 Swine Flu Sequence Analysis]]
10: ** [[User:Michael_Strong/H1N1/MP1/MSA|H1N1 Swine Flu Multiple Sequence Alignment]]
11: ...el Strong/H1N1/MP2/MSA|H1N1 Sequence Alignment of MP2 Protein]] - User:Michael Strong/H1N1/NA (258,192 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/3b7e 3b7e]' scene ='User:Michael_Strong/H1N1/NA/MSA/1/1'/>
29: |<scene name='User:Michael_Strong/H1N1/NA/MSA/83/1'>83</scene>
35: |<scene name='User:Michael_Strong/H1N1/NA/MSA/95/2'>95</scene>
41: |<scene name='User:Michael_Strong/H1N1/NA/MSA/96/2'>96</scene> - User:Michael Strong/H1N1/MP (265,936 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
3: ==MP1 Protein Structural Homolgy Model ==
5: ....php/2rlf 2rlf]' scene ='User:Michael_Strong/H1N1/MP/1/2'/>
7: ==MP1 Sequence Polymorphisms==
15: |MP1 - User:Michael Strong/H1N1/NS (152,680 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/3f5t 3f5t]' scene ='User:Michael_Strong/H1N1/NS1/MSA/1/1'/>
18: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/12/1'>12</scene>
24: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/32/1'>32</scene>
30: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/45/1'>45</scene> - User:Jaime Prilusky/Workbench/POTY2010 (4,243 bytes)
51: ... [[User:Michael Strong]] -- [[User:Michael_Strong/H1N1]] - Sandbox hemant (20,243 bytes)
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
22: ... alpha helices ({{Template:ColorKey_Strand}}, {{Template:ColorKey_Helix}}).
25: <center>{{Template:ColorKey_ConSurf}}</center>
27: ...Element_C}}, {{Template:ColorKey_Element_O}}, {{Template:ColorKey_Element_N}}.
37: For the meaning of &quot;H1N1&quot;, &quot;H2N2&quot;, etc. see [[#Influenza Vi...
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
