We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.

Search results

From Proteopedia

You searched for Michael_Strong/H1N1/MP

Jump to: navigation, search

There is no page with the exact title "Michael_Strong/H1N1/MP". The search results for "Michael_Strong/H1N1/MP" are displayed below. You can create a page titled Michael_Strong/H1N1/MP (by clicking on the red link).

For more information about searching Proteopedia, see Help.

To exclude pages titled with 4-character PDB codes, use the checkbox "only Human created pages" at the bottom of this page.

Showing below 15 results starting with #1.


View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

No page title matches

Page text matches

  1. Proteopedia:Page of the Year Entrants (2,819 bytes)
    1: ...ear Competition| Proteopedia's Page of the Year Competition]] here. You can enter as many pages as yo...
    2: ... then a link to the page you're entering in the competition.
    8: ...just an example, Eran cannot participate in the competition.
    18: # [[User:Tilman Schirmer]] -- [[C-di-GMP signaling]] (Note that there are several sub-page...
    27: ...ukrishna]] -- [[E.COLI OMPC - CAMEL LACTOFERRIN COMPLEX]]
  2. User:Michael Strong (964 bytes)
    9: '''H1N1 Swine Flu Genome and Protein Analysis:'''
    10: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    13: [[2g38|M. tuberculosis PE/PPE protein complex]] <font color="blue"></font>
    16: [[User:Michael_Strong/TB|M. tuberculosis Drug Resistance Mutations]] <f...
  3. Avian Influenza Neuraminidase, Tamiflu and Relenza (20,727 bytes)
    10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
    22: ... alpha helices ({{Template:ColorKey_Strand}}, {{Template:ColorKey_Helix}}).
    25: <center>{{Template:ColorKey_ConSurf}}</center>
    27: ...Element_C}}, {{Template:ColorKey_Element_O}}, {{Template:ColorKey_Element_N}}.
    37: For the meaning of &amp;quot;H1N1&amp;quot;, &amp;quot;H2N2&amp;quot;, etc. see [[#Influenza Vi...
  4. User:Michael Strong/H1N1 (61,695 bytes)
    1: '''2009 H1N1 swine flu genome and protein analysis'''
    3: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    6: ...ng Multiple Sequence Alignments of newly sequence H1N1 strains, Sequence Polymorphisms, and Related Sequ...
    8: ...B1, PA, HA, NP, NA, MP, and NS proteins from 2009 H1N1 strains from Mexico, California, Texas, New York,...
    12: ...index.php/3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' />
  5. User:Michael Strong/H1N1/PB2 (362,698 bytes)
    1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    5: ...index.php/3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' />
    64: |<scene name='User:Michael_Strong/H1N1/PB2/MSA/2/1'>G698</scene>
    70: H1N1 Swine Flu Multiple Sequence Alignment of PB2 Prot...
    397: gi|229892692_A/Mexico/InDRE411 IESIDNVMGMIGIMPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR 500
  6. User:Michael Strong/H1N1/PB1 (389,962 bytes)
    1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    70: H1N1 Swine Flu Multiple Sequence Alignment of PB1 Prot...
    565: ... IRNLHIPEVCLKWELMDDDYRGRLCNPLNPFVSHKEIDSVNNAVVMPAHG 650
    566: ... IRNLHIPEVCLKWELMDDDYRGRLCNPLNPFVSHKEIDSVNNAVVMPAHG 650
    567: ... IRNLHIPEVCLKWELMDDDYRGRLCNPLNPFVSHKEIDSVNNAVVMPAHG 650
  7. User:Michael Strong/H1N1/PA (354,535 bytes)
    1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    5: ...index.php/3cm8 3cm8]' scene ='User:Michael_Strong/H1N1/PA/MSA/1/1'/>
    24: |<scene name='User:Michael_Strong/H1N1/PA/MSA/269/2'>269</scene>
    30: |<scene name='User:Michael_Strong/H1N1/PA/MSA/275/3'>275</scene>
    36: |<scene name='User:Michael_Strong/H1N1/PA/MSA/581/2'>581</scene>
  8. User:Michael Strong/H1N1/HA (303,506 bytes)
    1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    5: ...index.php/3gbn 3gbn]' scene ='User:Michael_Strong/H1N1/HA/MSA/1/1'/>
    34: |<scene name='User:Michael_Strong/H1N1/HA/MSA/48/1'>48</scene>
    40: |<scene name='User:Michael_Strong/H1N1/HA/MSA/49/1'>49</scene>
    46: |<scene name='User:Michael_Strong/H1N1/HA/MSA/96/1'>96</scene>
  9. User:Michael Strong/H1N1/NP (283,820 bytes)
    1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    5: ...index.php/2q06 2q06]' scene ='User:Michael_Strong/H1N1/NP/MSA/1/1'/>
    24: |<scene name='User:Michael_Strong/H1N1/NP/MSA/35/1'>35</scene>
    30: |<scene name='User:Michael_Strong/H1N1/NP/MSA/90/1'>90</scene>
    36: |<scene name='User:Michael_Strong/H1N1/NP/MSA/106/1'>106</scene>
  10. Influenza (3,054 bytes)
    1: ...H1N1_navbox.jpg|350px|right|thumb| Picture of the H1N1 Influenza Virus]]
    8: * H1N1 Sequence Analyses
    9: ** [[User:Michael_Strong/H1N1|H1N1 Swine Flu Sequence Analysis]]
    10: ** [[User:Michael_Strong/H1N1/MP1/MSA|H1N1 Swine Flu Multiple Sequence Alignment]]
    11: ...el Strong/H1N1/MP2/MSA|H1N1 Sequence Alignment of MP2 Protein]]
  11. User:Michael Strong/H1N1/NA (258,192 bytes)
    1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    5: ...index.php/3b7e 3b7e]' scene ='User:Michael_Strong/H1N1/NA/MSA/1/1'/>
    29: |<scene name='User:Michael_Strong/H1N1/NA/MSA/83/1'>83</scene>
    35: |<scene name='User:Michael_Strong/H1N1/NA/MSA/95/2'>95</scene>
    41: |<scene name='User:Michael_Strong/H1N1/NA/MSA/96/2'>96</scene>
  12. User:Michael Strong/H1N1/MP (265,936 bytes)
    1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    3: ==MP1 Protein Structural Homolgy Model ==
    5: ....php/2rlf 2rlf]' scene ='User:Michael_Strong/H1N1/MP/1/2'/>
    7: ==MP1 Sequence Polymorphisms==
    15: |MP1
  13. User:Michael Strong/H1N1/NS (152,680 bytes)
    1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
    5: ...index.php/3f5t 3f5t]' scene ='User:Michael_Strong/H1N1/NS1/MSA/1/1'/>
    18: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/12/1'>12</scene>
    24: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/32/1'>32</scene>
    30: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/45/1'>45</scene>
  14. User:Jaime Prilusky/Workbench/POTY2010 (4,243 bytes)
    51: ... [[User:Michael Strong]] -- [[User:Michael_Strong/H1N1]]
  15. Sandbox hemant (20,243 bytes)
    10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
    22: ... alpha helices ({{Template:ColorKey_Strand}}, {{Template:ColorKey_Helix}}).
    25: <center>{{Template:ColorKey_ConSurf}}</center>
    27: ...Element_C}}, {{Template:ColorKey_Element_O}}, {{Template:ColorKey_Element_N}}.
    37: For the meaning of &amp;quot;H1N1&amp;quot;, &amp;quot;H2N2&amp;quot;, etc. see [[#Influenza Vi...

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)



Search in namespaces:

Include only Seeded (Automatic) pages - only Human created pages
List redirects
Search for

You may also try
Views
Personal tools