Search results
From Proteopedia
You searched for Michael_Strong/H1N1/PA/MSA
There is no page with the exact title "Michael_Strong/H1N1/PA/MSA". The search results for "Michael_Strong/H1N1/PA/MSA" are displayed below. You can create a page titled Michael_Strong/H1N1/PA/MSA (by clicking on the red link).
For more information about searching Proteopedia, see Help.
Showing below 15 results starting with #1.
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
No page title matches
Page text matches
- Proteopedia:Page of the Year Entrants (2,819 bytes)
1: ...e Year Competition]] here. You can enter as many pages as you like.
2: ...page followed by 2 hyphens and then a link to the page you're entering in the competition.
8: ...y number 1 is just an example, Eran cannot participate in the competition.
18: ...-GMP signaling]] (Note that there are several sub-pages)
22: # [[User:Paula Grabowski]] -- [[Triosephosphate Isomerase]] - User:Michael Strong (964 bytes)
9: '''H1N1 Swine Flu Genome and Protein Analysis:'''
10: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
16: [[User:Michael_Strong/TB|M. tuberculosis Drug Resistance Mutations]] <f... - Avian Influenza Neuraminidase, Tamiflu and Relenza (20,727 bytes)
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
11: ... including references for the points made in this paragraph, please see [http://en.wikipedia.org/wiki/...
31: ==Pandemic Influenza==
33: [http://en.wikipedia.org/wiki/Pandemic Pandemics] occur when localized [http://en.wikipedia...
35: ===Past Influenza Pandemics=== - User:Michael Strong/H1N1 (61,695 bytes)
1: '''2009 H1N1 swine flu genome and protein analysis'''
3: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
6: ...e Homologs are provided on the individual protein pages (links above).
8: ...B1, PA, HA, NP, NA, MP, and NS proteins from 2009 H1N1 strains from Mexico, California, Texas, New York,...
12: .../3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' /> - User:Michael Strong/H1N1/PB2 (362,698 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: .../3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' />
64: |<scene name='User:Michael_Strong/H1N1/PB2/MSA/2/1'>G698</scene>
70: H1N1 Swine Flu Multiple Sequence Alignment of PB2 Prot...
73: ...53 MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50 - User:Michael Strong/H1N1/PB1 (389,962 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
70: H1N1 Swine Flu Multiple Sequence Alignment of PB1 Prot...
73: gi|227977138_A/Texas/04/2009 MDVNPTLLFLKIPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYS 50
74: gi|237511919_A/Mexico/4486/200 MDVNPTLLFLKIPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYS 50
75: gi|227977130_A/Texas/05/2009 MDVNPTLLFLKIPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYS 50 - User:Michael Strong/H1N1/PA (354,535 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/3cm8 3cm8]' scene ='User:Michael_Strong/H1N1/PA/MSA/1/1'/>
15: |PA
20: |PA
24: |<scene name='User:Michael_Strong/H1N1/PA/MSA/269/2'>269</scene> - User:Michael Strong/H1N1/HA (303,506 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/3gbn 3gbn]' scene ='User:Michael_Strong/H1N1/HA/MSA/1/1'/>
34: |<scene name='User:Michael_Strong/H1N1/HA/MSA/48/1'>48</scene>
40: |<scene name='User:Michael_Strong/H1N1/HA/MSA/49/1'>49</scene>
46: |<scene name='User:Michael_Strong/H1N1/HA/MSA/96/1'>96</scene> - User:Michael Strong/H1N1/NP (283,820 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/2q06 2q06]' scene ='User:Michael_Strong/H1N1/NP/MSA/1/1'/>
24: |<scene name='User:Michael_Strong/H1N1/NP/MSA/35/1'>35</scene>
30: |<scene name='User:Michael_Strong/H1N1/NP/MSA/90/1'>90</scene>
36: |<scene name='User:Michael_Strong/H1N1/NP/MSA/106/1'>106</scene> - Influenza (3,024 bytes)
1: ...H1N1_navbox.jpg|350px|right|thumb| Picture of the H1N1 Influenza Virus]]
8: * H1N1 Sequence Analyses
9: ** [[User:Michael_Strong/H1N1|H1N1 Swine Flu Sequence Analysis]]
10: ** [[User:Michael_Strong/H1N1/MP1/MSA|H1N1 Swine Flu Multiple Sequence Alignment]]
11: ** [[User:Michael Strong/H1N1/MP2/MSA|H1N1 Sequence Alignment of MP2 Protein]] - User:Michael Strong/H1N1/NA (258,192 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/3b7e 3b7e]' scene ='User:Michael_Strong/H1N1/NA/MSA/1/1'/>
29: |<scene name='User:Michael_Strong/H1N1/NA/MSA/83/1'>83</scene>
35: |<scene name='User:Michael_Strong/H1N1/NA/MSA/95/2'>95</scene>
41: |<scene name='User:Michael_Strong/H1N1/NA/MSA/96/2'>96</scene> - User:Michael Strong/H1N1/MP (265,936 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/2rlf 2rlf]' scene ='User:Michael_Strong/H1N1/MP/1/2'/>
19: |<scene name='User:Michael_Strong/H1N1/MP/3/2'>3</scene>
34: H1N1 Swine Flu Multiple Sequence Alignment of MP1 Prot...
84: gi|229462710_A/Pais_Vasco/GP20 MSLLTEVETYVLSIIPSGPLKAEIAQRLESV... - User:Michael Strong/H1N1/NS (152,680 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: .../3f5t 3f5t]' scene ='User:Michael_Strong/H1N1/NS1/MSA/1/1'/>
18: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/12/1'>12</scene>
24: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/32/1'>32</scene>
30: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/45/1'>45</scene> - User:Jaime Prilusky/Workbench/POTY2010 (4,243 bytes)
16: ** Linking to other Proteopedia pages
26: ** Linking to other Proteopedia pages
37: ** Linking to other Proteopedia pages
48: ** 0 Linking to other Proteopedia pages
51: ... [[User:Michael Strong]] -- [[User:Michael_Strong/H1N1]] - Sandbox hemant (20,243 bytes)
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
11: ... including references for the points made in this paragraph, please see [http://en.wikipedia.org/wiki/...
31: ==Pandemic Influenza==
33: [http://en.wikipedia.org/wiki/Pandemic Pandemics] occur when localized [http://en.wikipedia...
35: ===Past Influenza Pandemics===
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)