This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.
Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.
Search results
From Proteopedia
You searched for Michael_Strong/H1N1/PA/MSA
There is no page with the exact title "Michael_Strong/H1N1/PA/MSA". The search results for "Michael_Strong/H1N1/PA/MSA" are displayed below. You can create a page titled Michael_Strong/H1N1/PA/MSA (by clicking on the red link).
For more information about searching Proteopedia, see Help.
Showing below 15 results starting with #1.
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
No page title matches
Page text matches
- Proteopedia:Page of the Year Entrants (2,819 bytes)
1: ...e Year Competition]] here. You can enter as many pages as you like.
2: ...page followed by 2 hyphens and then a link to the page you're entering in the competition.
8: ...y number 1 is just an example, Eran cannot participate in the competition.
18: ...-GMP signaling]] (Note that there are several sub-pages)
22: # [[User:Paula Grabowski]] -- [[Triosephosphate Isomerase]] - User:Michael Strong (964 bytes)
9: '''H1N1 Swine Flu Genome and Protein Analysis:'''
10: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
16: [[User:Michael_Strong/TB|M. tuberculosis Drug Resistance Mutations]] <f... - Avian Influenza Neuraminidase, Tamiflu and Relenza (20,727 bytes)
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
11: ... including references for the points made in this paragraph, please see [http://en.wikipedia.org/wiki/...
31: ==Pandemic Influenza==
33: [http://en.wikipedia.org/wiki/Pandemic Pandemics] occur when localized [http://en.wikipedia...
35: ===Past Influenza Pandemics=== - User:Michael Strong/H1N1 (61,695 bytes)
1: '''2009 H1N1 swine flu genome and protein analysis'''
3: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
6: ...e Homologs are provided on the individual protein pages (links above).
8: ...B1, PA, HA, NP, NA, MP, and NS proteins from 2009 H1N1 strains from Mexico, California, Texas, New York,...
12: .../3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' /> - User:Michael Strong/H1N1/PB2 (362,698 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: .../3cw4 3cw4]' scene ='User:Michael_Strong/H1N1/PB2/MSA/1/1' />
64: |<scene name='User:Michael_Strong/H1N1/PB2/MSA/2/1'>G698</scene>
70: H1N1 Swine Flu Multiple Sequence Alignment of PB2 Prot...
73: ...53 MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50 - User:Michael Strong/H1N1/PB1 (389,962 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
70: H1N1 Swine Flu Multiple Sequence Alignment of PB1 Prot...
73: gi|227977138_A/Texas/04/2009 MDVNPTLLFLKIPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYS 50
74: gi|237511919_A/Mexico/4486/200 MDVNPTLLFLKIPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYS 50
75: gi|227977130_A/Texas/05/2009 MDVNPTLLFLKIPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYS 50 - User:Michael Strong/H1N1/PA (354,535 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/3cm8 3cm8]' scene ='User:Michael_Strong/H1N1/PA/MSA/1/1'/>
15: |PA
20: |PA
24: |<scene name='User:Michael_Strong/H1N1/PA/MSA/269/2'>269</scene> - User:Michael Strong/H1N1/HA (303,506 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/3gbn 3gbn]' scene ='User:Michael_Strong/H1N1/HA/MSA/1/1'/>
34: |<scene name='User:Michael_Strong/H1N1/HA/MSA/48/1'>48</scene>
40: |<scene name='User:Michael_Strong/H1N1/HA/MSA/49/1'>49</scene>
46: |<scene name='User:Michael_Strong/H1N1/HA/MSA/96/1'>96</scene> - User:Michael Strong/H1N1/NP (283,820 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/2q06 2q06]' scene ='User:Michael_Strong/H1N1/NP/MSA/1/1'/>
24: |<scene name='User:Michael_Strong/H1N1/NP/MSA/35/1'>35</scene>
30: |<scene name='User:Michael_Strong/H1N1/NP/MSA/90/1'>90</scene>
36: |<scene name='User:Michael_Strong/H1N1/NP/MSA/106/1'>106</scene> - Influenza (3,024 bytes)
1: ...H1N1_navbox.jpg|350px|right|thumb| Picture of the H1N1 Influenza Virus]]
8: * H1N1 Sequence Analyses
9: ** [[User:Michael_Strong/H1N1|H1N1 Swine Flu Sequence Analysis]]
10: ** [[User:Michael_Strong/H1N1/MP1/MSA|H1N1 Swine Flu Multiple Sequence Alignment]]
11: ** [[User:Michael Strong/H1N1/MP2/MSA|H1N1 Sequence Alignment of MP2 Protein]] - User:Michael Strong/H1N1/NA (258,192 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...p/3b7e 3b7e]' scene ='User:Michael_Strong/H1N1/NA/MSA/1/1'/>
29: |<scene name='User:Michael_Strong/H1N1/NA/MSA/83/1'>83</scene>
35: |<scene name='User:Michael_Strong/H1N1/NA/MSA/95/2'>95</scene>
41: |<scene name='User:Michael_Strong/H1N1/NA/MSA/96/2'>96</scene> - User:Michael Strong/H1N1/MP (265,936 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: ...index.php/2rlf 2rlf]' scene ='User:Michael_Strong/H1N1/MP/1/2'/>
19: |<scene name='User:Michael_Strong/H1N1/MP/3/2'>3</scene>
34: H1N1 Swine Flu Multiple Sequence Alignment of MP1 Prot...
84: gi|229462710_A/Pais_Vasco/GP20 MSLLTEVETYVLSIIPSGPLKAEIAQRLESV... - User:Michael Strong/H1N1/NS (152,680 bytes)
1: ...nt color="blue">•</font> [[User:Michael_Strong/H1N1/NS|NS]]
5: .../3f5t 3f5t]' scene ='User:Michael_Strong/H1N1/NS1/MSA/1/1'/>
18: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/12/1'>12</scene>
24: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/32/1'>32</scene>
30: |<scene name='User:Michael_Strong/H1N1/NS1/MSA/45/1'>45</scene> - User:Jaime Prilusky/Workbench/POTY2010 (4,243 bytes)
16: ** Linking to other Proteopedia pages
26: ** Linking to other Proteopedia pages
37: ** Linking to other Proteopedia pages
48: ** 0 Linking to other Proteopedia pages
51: ... [[User:Michael Strong]] -- [[User:Michael_Strong/H1N1]] - Sandbox hemant (20,243 bytes)
10: ...o various numbered serotypes or subtypes, such as H1N1, H2N2, H3N2, H5N1, and so forth<ref name="fluwiki...
11: ... including references for the points made in this paragraph, please see [http://en.wikipedia.org/wiki/...
31: ==Pandemic Influenza==
33: [http://en.wikipedia.org/wiki/Pandemic Pandemics] occur when localized [http://en.wikipedia...
35: ===Past Influenza Pandemics===
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
You may also try
