Search results

From Proteopedia

You searched for Sobol,_A.G.

Jump to: navigation, search

There is no page with the exact title "Sobol,_A.G.". The search results for "Sobol,_A.G." are displayed below. You can create a page titled Sobol,_A.G. (by clicking on the red link).

For more information about searching Proteopedia, see Help.

To exclude pages titled with 4-character PDB codes, use the checkbox "only Human created pages" at the bottom of this page.

Showing below up to 20 results starting with #1.


View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

Article title matches

  1. Category:Sobol M (38 bytes)
    1: List of pages with the keyword Sobol M
  2. Category:Sobol VA (39 bytes)
    1: List of pages with the keyword Sobol VA
  3. Category:Sobol, A (39 bytes)
    1: List of pages with the keyword Sobol, A
  4. Category:Sobol, A G (41 bytes)
    1: List of pages with the keyword Sobol, A G
  5. Category:Sobol, V A (41 bytes)
    1: List of pages with the keyword Sobol, V A
  6. Category:Sobol A (38 bytes)
    1: List of pages with the keyword Sobol A
  7. Category:Sobol AG (39 bytes)
    1: List of pages with the keyword Sobol AG

Page text matches

  1. Category:Sobol M (38 bytes)
    1: List of pages with the keyword Sobol M
  2. 1eci (3,869 bytes)
    3: <StructureSection load='1eci' size='340' side='right'caption='[[1eci]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1ECI FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1eci PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1eci ProSAT]</span&gt;</td&gt;...
    10: ...oncentrations (0.5-1 uM), it acts as a pore-forming protein that forms nonselective cation channels b...
  3. 1rqs (4,570 bytes)
    3: <StructureSection load='1rqs' size='340' side='right'caption='[[1rqs]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQS FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1rqs PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqs ProSAT]</span&gt;</td&gt;...
    10: ...niprot/RL7_ECOLI RL7_ECOLI] Seems to be the binding site for several of the factors involved in prote...
  4. 1rqt (3,497 bytes)
    3: <StructureSection load='1rqt' size='340' side='right'caption='[[1rqt]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQT FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1rqt PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqt ProSAT]</span&gt;</td&gt;...
    10: ...niprot/RL7_ECOLI RL7_ECOLI] Seems to be the binding site for several of the factors involved in prote...
  5. 1rqu (4,204 bytes)
    3: <StructureSection load='1rqu' size='340' side='right'caption='[[1rqu]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQU FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1rqu PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqu ProSAT]</span&gt;</td&gt;...
    10: ...niprot/RL7_ECOLI RL7_ECOLI] Seems to be the binding site for several of the factors involved in prote...
  6. 1rqv (4,243 bytes)
    2: ...al model of L7 dimer from E.coli with one hinge region in helical state==
    3: <StructureSection load='1rqv' size='340' side='right'caption='[[1rqv]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQV FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1rqv PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqv ProSAT]</span&gt;</td&gt;...
  7. 1znu (4,474 bytes)
    3: <StructureSection load='1znu' size='340' side='right'caption='[[1znu]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1ZNU FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1znu PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1znu ProSAT]</span&gt;</td&gt;...
    10: ...the growth and development of larvae from H.punctigera. The unmodified form has hemolytic activity, t...
  8. 2jwa (7,247 bytes)
    2: ==ErbB2 transmembrane segment dimer spatial structure==
    3: <StructureSection load='2jwa' size='340' side='right'caption='[[2jwa]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=2JWA FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/2jwa PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2jwa ProSAT]</span&gt;</td&gt;...
  9. 2jwm (3,579 bytes)
    3: <StructureSection load='2jwm' size='340' side='right'caption='[[2jwm]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=2JWM FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/2jwm PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2jwm ProSAT]</span&gt;</td&gt;...
    10: [https://www.uniprot.org/uniprot/KAB7_OLDAF KAB7_OLDAF] Probably participa...
  10. 2kus (1,366 bytes)
    3: <StructureSection load='2kus' size='340' side='right'caption='[[2kus]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=2KUS FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/2kus PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2kus ProSAT]</span&gt;</td&gt;...
    11: [[Category: Large Structures]]
  11. Category:Sobol VA (39 bytes)
    1: List of pages with the keyword Sobol VA
  12. Category:Sobol, A (39 bytes)
    1: List of pages with the keyword Sobol, A
  13. Category:Sobol, A G (41 bytes)
    1: List of pages with the keyword Sobol, A G
  14. Category:Sobol, V A (41 bytes)
    1: List of pages with the keyword Sobol, V A
  15. 5fhz (4,101 bytes)
    2: ==Human aldehyde dehydrogenase 1A3 complexed with NAD(+) and retinoic acid=...
    3: ...ion='[[5fhz]], [[Resolution|resolution]] 2.90&Aring;' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=5FHZ FirstGlance]. <br&gt;
    7: ...NINE-DINUCLEOTIDE'&gt;NAD</scene&gt;, <scene name='pdbligand=REA:RETINOIC+ACID'&gt;REA</scene&gt;</td&gt;</tr&gt;
  16. Sandbox Reserved 1228 (3,816 bytes)
    2: <StructureSection load='1eci' size='340' side='right' caption='Ectatomin'</scene&gt;
    3: ...ell leads to an irreversible increase in ion leakage, a decrease in membrane resistance, and eventual...
    8: ...queous solution. [3] The toxin has a molecular weight of 7,928 Da. [2]
    12: ...ies between the two side chains, along with homologies to other proteins. [5]
    16: ...e as followed: GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL [4]
  17. 5oqk (4,011 bytes)
    2: ...R structure of truncated, human Hv1/VSOP (Voltage-gated proton channel)==
    3: <StructureSection load='5oqk' size='340' side='right'caption='[[5oqk]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=5OQK FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/5oqk PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=5oqk ProSAT]</span&gt;</td&gt;...
  18. 9ewy (3,331 bytes)
    3: ...ion='[[9ewy]], [[Resolution|resolution]] 3.10&Aring;' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=9EWY FirstGlance]. <br&gt;
    7: ...NINE+DINUCLEOTIDE'&gt;FAD</scene&gt;, <scene name='pdbligand=ZN:ZINC+ION'&gt;ZN</scene&gt;</td&gt;</tr&gt;
    8: ...c.uk/pdbsum/9ewy PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=9ewy ProSAT]</span&gt;</td&gt;...
  19. Category:Sobol A (38 bytes)
    1: List of pages with the keyword Sobol A
  20. 6tgw (4,250 bytes)
    2: ==Crystal structure of human Aldehyde dehydrogenase 1A3 in complex with a selective inhibitor==
    3: ...ion='[[6tgw]], [[Resolution|resolution]] 2.80&Aring;' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=6TGW FirstGlance]. <br&gt;
    7: ...ine-7-carboxylate'&gt;N98</scene&gt;, <scene name='pdbligand=NAD:NICOTINAMIDE-ADENINE-DINUCLEOTIDE'&gt;NAD</sc...

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)



Search in namespaces:

Include only Seeded (Automatic) pages - only Human created pages
List redirects
Search for

You may also try
Views
Personal tools