We apologize for Proteopedia being slow to respond. For the past two years, a new implementation of Proteopedia has been being built. Soon, it will replace this 18-year old system. All existing content will be moved to the new system at a date that will be announced here.
Search results
From Proteopedia
You searched for Sobol,_A.G.
There is no page with the exact title "Sobol,_A.G.". The search results for "Sobol,_A.G." are displayed below. You can create a page titled Sobol,_A.G. (by clicking on the red link).
For more information about searching Proteopedia, see Help.
To exclude pages titled with 4-character PDB codes, use the checkbox "only Human created pages" at the bottom of this page.
Showing below up to 20 results starting with #1.
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
Article title matches
- Category:Sobol M (38 bytes)
1: List of pages with the keyword Sobol M - Category:Sobol VA (39 bytes)
1: List of pages with the keyword Sobol VA - Category:Sobol, A (39 bytes)
1: List of pages with the keyword Sobol, A - Category:Sobol, A G (41 bytes)
1: List of pages with the keyword Sobol, A G - Category:Sobol, V A (41 bytes)
1: List of pages with the keyword Sobol, V A - Category:Sobol A (38 bytes)
1: List of pages with the keyword Sobol A - Category:Sobol AG (39 bytes)
1: List of pages with the keyword Sobol AG
Page text matches
- Category:Sobol M (38 bytes)
1: List of pages with the keyword Sobol M - 1eci (3,869 bytes)
3: <StructureSection load='1eci' size='340' side='right'caption='[[1eci]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=1ECI FirstGlance]. <br>
7: ...c.uk/pdbsum/1eci PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1eci ProSAT]</span></td>...
10: ...oncentrations (0.5-1 uM), it acts as a pore-forming protein that forms nonselective cation channels b... - 1rqs (4,570 bytes)
3: <StructureSection load='1rqs' size='340' side='right'caption='[[1rqs]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQS FirstGlance]. <br>
7: ...c.uk/pdbsum/1rqs PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqs ProSAT]</span></td>...
10: ...niprot/RL7_ECOLI RL7_ECOLI] Seems to be the binding site for several of the factors involved in prote... - 1rqt (3,497 bytes)
3: <StructureSection load='1rqt' size='340' side='right'caption='[[1rqt]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQT FirstGlance]. <br>
7: ...c.uk/pdbsum/1rqt PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqt ProSAT]</span></td>...
10: ...niprot/RL7_ECOLI RL7_ECOLI] Seems to be the binding site for several of the factors involved in prote... - 1rqu (4,204 bytes)
3: <StructureSection load='1rqu' size='340' side='right'caption='[[1rqu]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQU FirstGlance]. <br>
7: ...c.uk/pdbsum/1rqu PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqu ProSAT]</span></td>...
10: ...niprot/RL7_ECOLI RL7_ECOLI] Seems to be the binding site for several of the factors involved in prote... - 1rqv (4,243 bytes)
2: ...al model of L7 dimer from E.coli with one hinge region in helical state==
3: <StructureSection load='1rqv' size='340' side='right'caption='[[1rqv]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQV FirstGlance]. <br>
7: ...c.uk/pdbsum/1rqv PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqv ProSAT]</span></td>... - 1znu (4,474 bytes)
3: <StructureSection load='1znu' size='340' side='right'caption='[[1znu]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=1ZNU FirstGlance]. <br>
7: ...c.uk/pdbsum/1znu PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1znu ProSAT]</span></td>...
10: ...the growth and development of larvae from H.punctigera. The unmodified form has hemolytic activity, t... - 2jwa (7,247 bytes)
2: ==ErbB2 transmembrane segment dimer spatial structure==
3: <StructureSection load='2jwa' size='340' side='right'caption='[[2jwa]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=2JWA FirstGlance]. <br>
7: ...c.uk/pdbsum/2jwa PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2jwa ProSAT]</span></td>... - 2jwm (3,579 bytes)
3: <StructureSection load='2jwm' size='340' side='right'caption='[[2jwm]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=2JWM FirstGlance]. <br>
7: ...c.uk/pdbsum/2jwm PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2jwm ProSAT]</span></td>...
10: [https://www.uniprot.org/uniprot/KAB7_OLDAF KAB7_OLDAF] Probably participa... - 2kus (1,366 bytes)
3: <StructureSection load='2kus' size='340' side='right'caption='[[2kus]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=2KUS FirstGlance]. <br>
7: ...c.uk/pdbsum/2kus PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2kus ProSAT]</span></td>...
11: [[Category: Large Structures]] - Category:Sobol VA (39 bytes)
1: List of pages with the keyword Sobol VA - Category:Sobol, A (39 bytes)
1: List of pages with the keyword Sobol, A - Category:Sobol, A G (41 bytes)
1: List of pages with the keyword Sobol, A G - Category:Sobol, V A (41 bytes)
1: List of pages with the keyword Sobol, V A - 5fhz (4,101 bytes)
2: ==Human aldehyde dehydrogenase 1A3 complexed with NAD(+) and retinoic acid=...
3: ...ion='[[5fhz]], [[Resolution|resolution]] 2.90Å' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=5FHZ FirstGlance]. <br>
7: ...NINE-DINUCLEOTIDE'>NAD</scene>, <scene name='pdbligand=REA:RETINOIC+ACID'>REA</scene></td></tr> - Sandbox Reserved 1228 (3,816 bytes)
2: <StructureSection load='1eci' size='340' side='right' caption='Ectatomin'</scene>
3: ...ell leads to an irreversible increase in ion leakage, a decrease in membrane resistance, and eventual...
8: ...queous solution. [3] The toxin has a molecular weight of 7,928 Da. [2]
12: ...ies between the two side chains, along with homologies to other proteins. [5]
16: ...e as followed: GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL [4] - 5oqk (4,011 bytes)
2: ...R structure of truncated, human Hv1/VSOP (Voltage-gated proton channel)==
3: <StructureSection load='5oqk' size='340' side='right'caption='[[5oqk]]' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=5OQK FirstGlance]. <br>
7: ...c.uk/pdbsum/5oqk PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=5oqk ProSAT]</span></td>... - 9ewy (3,331 bytes)
3: ...ion='[[9ewy]], [[Resolution|resolution]] 3.10Å' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=9EWY FirstGlance]. <br>
7: ...NINE+DINUCLEOTIDE'>FAD</scene>, <scene name='pdbligand=ZN:ZINC+ION'>ZN</scene></td></tr>
8: ...c.uk/pdbsum/9ewy PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=9ewy ProSAT]</span></td>... - Category:Sobol A (38 bytes)
1: List of pages with the keyword Sobol A - 6tgw (4,250 bytes)
2: ==Crystal structure of human Aldehyde dehydrogenase 1A3 in complex with a selective inhibitor==
3: ...ion='[[6tgw]], [[Resolution|resolution]] 2.80Å' scene=''>
4: == Structural highlights ==
5: ...https://proteopedia.org/fgij/fg.htm?mol=6TGW FirstGlance]. <br>
7: ...ine-7-carboxylate'>N98</scene>, <scene name='pdbligand=NAD:NICOTINAMIDE-ADENINE-DINUCLEOTIDE'>NAD</sc...
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
You may also try
