This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


Search results

From Proteopedia

You searched for Sobol,_A.G.

Jump to: navigation, search

There is no page with the exact title "Sobol,_A.G.". The search results for "Sobol,_A.G." are displayed below. You can create a page titled Sobol,_A.G. (by clicking on the red link).

For more information about searching Proteopedia, see Help.

To exclude pages titled with 4-character PDB codes, use the checkbox "only Human created pages" at the bottom of this page.

Showing below up to 20 results starting with #1.


View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)

Article title matches

  1. Category:Sobol VA (39 bytes)
    1: List of pages with the keyword Sobol VA
  2. Category:Sobol, A (39 bytes)
    1: List of pages with the keyword Sobol, A
  3. Category:Sobol, A G (41 bytes)
    1: List of pages with the keyword Sobol, A G
  4. Category:Sobol, V A (41 bytes)
    1: List of pages with the keyword Sobol, V A
  5. Category:Sobol A (38 bytes)
    1: List of pages with the keyword Sobol A
  6. Category:Sobol AG (39 bytes)
    1: List of pages with the keyword Sobol AG

Page text matches

  1. 1eci (3,858 bytes)
    3: <StructureSection load='1eci' size='340' side='right'caption='[[1eci]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1ECI FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1eci PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1eci ProSAT]</span&gt;</td&gt;...
    10: ...oncentrations (0.5-1 uM), it acts as a pore-forming protein that forms nonselective cation channels b...
  2. 1rqs (4,570 bytes)
    3: <StructureSection load='1rqs' size='340' side='right'caption='[[1rqs]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQS FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1rqs PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqs ProSAT]</span&gt;</td&gt;...
    10: ...niprot/RL7_ECOLI RL7_ECOLI] Seems to be the binding site for several of the factors involved in prote...
  3. 1rqt (3,497 bytes)
    3: <StructureSection load='1rqt' size='340' side='right'caption='[[1rqt]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQT FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1rqt PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqt ProSAT]</span&gt;</td&gt;...
    10: ...niprot/RL7_ECOLI RL7_ECOLI] Seems to be the binding site for several of the factors involved in prote...
  4. 1rqu (4,204 bytes)
    3: <StructureSection load='1rqu' size='340' side='right'caption='[[1rqu]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQU FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1rqu PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqu ProSAT]</span&gt;</td&gt;...
    10: ...niprot/RL7_ECOLI RL7_ECOLI] Seems to be the binding site for several of the factors involved in prote...
  5. 1rqv (4,243 bytes)
    2: ...al model of L7 dimer from E.coli with one hinge region in helical state==
    3: <StructureSection load='1rqv' size='340' side='right'caption='[[1rqv]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1RQV FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1rqv PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1rqv ProSAT]</span&gt;</td&gt;...
  6. 1znu (4,463 bytes)
    3: <StructureSection load='1znu' size='340' side='right'caption='[[1znu]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=1ZNU FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/1znu PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=1znu ProSAT]</span&gt;</td&gt;...
    10: ...the growth and development of larvae from H.punctigera. The unmodified form has hemolytic activity, t...
  7. 2jwa (7,247 bytes)
    2: ==ErbB2 transmembrane segment dimer spatial structure==
    3: <StructureSection load='2jwa' size='340' side='right'caption='[[2jwa]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=2JWA FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/2jwa PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2jwa ProSAT]</span&gt;</td&gt;...
  8. 2jwm (3,568 bytes)
    3: <StructureSection load='2jwm' size='340' side='right'caption='[[2jwm]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=2JWM FirstGlance]. <br&gt;
    7: ...c.uk/pdbsum/2jwm PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2jwm ProSAT]</span&gt;</td&gt;...
    10: [https://www.uniprot.org/uniprot/KAB7_OLDAF KAB7_OLDAF] Probably participa...
  9. 2kus (1,217 bytes)
    3: <StructureSection load='2kus' size='340' side='right'caption='[[2kus]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=2KUS FirstGlance]. <br&gt;
    6: ...c.uk/pdbsum/2kus PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=2kus ProSAT]</span&gt;</td&gt;...
    10: [[Category: Large Structures]]
  10. Category:Sobol VA (39 bytes)
    1: List of pages with the keyword Sobol VA
  11. Category:Sobol, A (39 bytes)
    1: List of pages with the keyword Sobol, A
  12. Category:Sobol, A G (41 bytes)
    1: List of pages with the keyword Sobol, A G
  13. Category:Sobol, V A (41 bytes)
    1: List of pages with the keyword Sobol, V A
  14. 5fhz (4,101 bytes)
    2: ==Human aldehyde dehydrogenase 1A3 complexed with NAD(+) and retinoic acid=...
    3: ...ion='[[5fhz]], [[Resolution|resolution]] 2.90&Aring;' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=5FHZ FirstGlance]. <br&gt;
    7: ...NINE-DINUCLEOTIDE'&gt;NAD</scene&gt;, <scene name='pdbligand=REA:RETINOIC+ACID'&gt;REA</scene&gt;</td&gt;</tr&gt;
  15. Sandbox Reserved 1228 (3,816 bytes)
    2: <StructureSection load='1eci' size='340' side='right' caption='Ectatomin'</scene&gt;
    3: ...ell leads to an irreversible increase in ion leakage, a decrease in membrane resistance, and eventual...
    8: ...queous solution. [3] The toxin has a molecular weight of 7,928 Da. [2]
    12: ...ies between the two side chains, along with homologies to other proteins. [5]
    16: ...e as followed: GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL [4]
  16. 5oqk (3,873 bytes)
    2: ...R structure of truncated, human Hv1/VSOP (Voltage-gated proton channel)==
    3: <StructureSection load='5oqk' size='340' side='right'caption='[[5oqk]]' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=5OQK FirstGlance]. <br&gt;
    6: ...c.uk/pdbsum/5oqk PDBsum], [https://prosat.h-its.org/prosat/prosatexe?pdbcode=5oqk ProSAT]</span&gt;</td&gt;...
  17. Category:Sobol A (38 bytes)
    1: List of pages with the keyword Sobol A
  18. 6tgw (4,250 bytes)
    2: ==Crystal structure of human Aldehyde dehydrogenase 1A3 in complex with a selective inhibitor==
    3: ...ion='[[6tgw]], [[Resolution|resolution]] 2.80&Aring;' scene=''&gt;
    4: == Structural highlights ==
    5: ...https://proteopedia.org/fgij/fg.htm?mol=6TGW FirstGlance]. <br&gt;
    7: ...ine-7-carboxylate'&gt;N98</scene&gt;, <scene name='pdbligand=NAD:NICOTINAMIDE-ADENINE-DINUCLEOTIDE'&gt;NAD</sc...
  19. Category:Sobol AG (39 bytes)
    1: List of pages with the keyword Sobol AG

View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)



Search in namespaces:

Include only Seeded (Automatic) pages - only Human created pages
List redirects
Search for

You may also try
Views
Personal tools