Search results
From Proteopedia
You searched for Viet,_K.K
There is no page with the exact title "Viet,_K.K". The search results for "Viet,_K.K" are displayed below. You can create a page titled Viet,_K.K (by clicking on the red link).
For more information about searching Proteopedia, see Help.
Showing below up to 20 results starting with #1.
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)
Article title matches
- Category:A/viet nam/1203/2004 (51 bytes)
1: List of pages with the keyword A/viet nam/1203/2004 - Category:Viet, K K (40 bytes)
1: List of pages with the keyword Viet, K K - Category:Viet KK (38 bytes)
1: List of pages with the keyword Viet KK
Page text matches
- 8txt (5,251 bytes)
2: ... of 05.GC.w13.02 Fab in complex with H5 HA from A/Viet Nam/1203/2004(H5N1)==
5: ...(A/Viet_Nam/1203/2004(H5N1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=BMA:BET...
8: ...e.do?structureId=8txt RCSB], [https://www.ebi.ac.uk/pdbsum/8txt PDBsum], [https://prosat.h-its.org/pr... - 8zdw (2,795 bytes)
5: ...1203/2004(H5N1))] and [https://en.wikipedia.org/wiki/Mus_musculus Mus musculus]. Full crystallographi...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">Electron Microscopy, [[Resolut...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=BMA:BET...
8: ...e.do?structureId=8zdw RCSB], [https://www.ebi.ac.uk/pdbsum/8zdw PDBsum], [https://prosat.h-its.org/pr... - 2fk0 (5,365 bytes)
3: ...n load='2fk0' size='340' side='right'caption='[[2fk0]], [[Resolution|resolution]] 2.95Å' scene=...
5: ...b> use [https://proteopedia.org/fgij/fg.htm?mol=2FK0 FirstGlance]. <br>
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=BMA:BET...
8: ...tps://prosat.h-its.org/prosat/prosatexe?pdbcode=2fk0 ProSAT]</span></td></tr> - 3ckz (5,982 bytes)
3: ...n load='3ckz' size='340' side='right'caption='[[3ckz]], [[Resolution|resolution]] 1.90Å' scene=...
5: ...b> use [https://proteopedia.org/fgij/fg.htm?mol=3CKZ FirstGlance]. <br>
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=CA:CALC...
8: ...tps://prosat.h-its.org/prosat/prosatexe?pdbcode=3ckz ProSAT]</span></td></tr> - 3cl0 (6,418 bytes)
5: ...(A/Viet_Nam/1203/2004(H5N1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1))]. The May 2009 RCSB PDB [htt...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=CA:CALC...
8: ...e.do?structureId=3cl0 RCSB], [https://www.ebi.ac.uk/pdbsum/3cl0 PDBsum], [https://prosat.h-its.org/pr...
11: ...es on the mucin of the airway epithelial cells. Likely to plays a role in the budding process through... - 3cl2 (5,262 bytes)
5: ...(A/Viet_Nam/1203/2004(H5N1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=G39:(3R...
8: ...e.do?structureId=3cl2 RCSB], [https://www.ebi.ac.uk/pdbsum/3cl2 PDBsum], [https://prosat.h-its.org/pr...
11: ...es on the mucin of the airway epithelial cells. Likely to plays a role in the budding process through... - 3fku (5,486 bytes)
3: ...n load='3fku' size='340' side='right'caption='[[3fku]], [[Resolution|resolution]] 3.20Å' scene=...
5: ...b> use [https://proteopedia.org/fgij/fg.htm?mol=3FKU FirstGlance]. <br>
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=BMA:BET...
8: ...tps://prosat.h-its.org/prosat/prosatexe?pdbcode=3fku ProSAT]</span></td></tr> - 3gbm (5,322 bytes)
5: ...(A/Viet_Nam/1203/2004(H5N1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=BMA:BET...
8: ...e.do?structureId=3gbm RCSB], [https://www.ebi.ac.uk/pdbsum/3gbm PDBsum], [https://prosat.h-its.org/pr...
13: [[Image:Consurf_key_small.gif|200px|right]] - User:Michael Strong/H1N1/NA (258,192 bytes)
5: ...dentity to pdp template [http://proteopedia.org/wiki/index.php/3b7e 3b7e]' scene ='User:Michael_Stron...
9: {| class="wikitable"
21: |E57K
51: |gi|228481034_A/Auckland/3/2009
81: |gi|229396353_A/New_York/12/200 - User:Michael Strong/H1N1/MP (265,936 bytes)
5: ...dentity to pdp template [http://proteopedia.org/wiki/index.php/2rlf 2rlf]' scene ='User:Michael_Stron...
9: {| class="wikitable"
37: ... --LLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 48
38: ... MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50
39: ... MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP 50 - 3kc6 (3,393 bytes)
2: ...polymerase basic protein 2 from influenza virus a/viet nam/1203/2004 (h5n1)==
3: ...on load='3kc6' size='340' side='right'caption='[[3kc6]], [[Resolution|resolution]] 2.05Å' scene...
5: .../b> use [https://proteopedia.org/fgij/fg.htm?mol=3KC6 FirstGlance]. <br>
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=EDO:1,2... - 3l56 (3,338 bytes)
2: ...polymerase basic protein 2 from influenza virus a/viet nam/1203/2004 (h5n1)==
5: ...(A/Viet_Nam/1203/2004(H5N1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...e.do?structureId=3l56 RCSB], [https://www.ebi.ac.uk/pdbsum/3l56 PDBsum], [https://prosat.h-its.org/pr...
11: <div style="background-color:#fffaf0;"> - 3zp3 (4,724 bytes)
5: ...(a/viet_nam/1194/2004(h5n1)) Influenza a virus (a/viet nam/1194/2004(h5n1))]. Full crystallographic info...
6: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=GAL:BET...
7: ...ated_structure|Related:]]</b></td><td class="sblockDat"><div style='overflow: auto; max-height: 3em;'...
8: ...e.do?structureId=3zp3 RCSB], [https://www.ebi.ac.uk/pdbsum/3zp3 PDBsum], [https://prosat.h-its.org/pr...
12: <div style="background-color:#fffaf0;"> - 3p31 (3,211 bytes)
2: ...cture of the NS1 effector domain from influenza A/Vietnam/1203/2004 (H5N1) virus==
5: ...1203/2004(H5N1)) Influenza A virus (A/environment/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=SCN:THI...
8: ...e.do?structureId=3p31 RCSB], [https://www.ebi.ac.uk/pdbsum/3p31 PDBsum], [https://prosat.h-its.org/pr... - 3p38 (3,075 bytes)
2: ...NS1 effector domain W182A mutant from influenza A/Vietnam/1203/2004 (H5N1) virus==
5: ...1203/2004(H5N1)) Influenza A virus (A/environment/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...e.do?structureId=3p38 RCSB], [https://www.ebi.ac.uk/pdbsum/3p38 PDBsum], [https://prosat.h-its.org/pr...
10: ...and RNA, or by interacting directly with EIF2AK2/PKR. This function may be important at the very begi... - 3p39 (3,075 bytes)
2: ...NS1 effector domain W182A mutant from influenza A/Vietnam/1203/2004 (H5N1) virus==
5: ...1203/2004(H5N1)) Influenza A virus (A/environment/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...e.do?structureId=3p39 RCSB], [https://www.ebi.ac.uk/pdbsum/3p39 PDBsum], [https://prosat.h-its.org/pr...
10: ...and RNA, or by interacting directly with EIF2AK2/PKR. This function may be important at the very begi... - 4e5e (1,770 bytes)
5: ...(A/Viet_Nam/1203/2004(H5N1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=MN:MANG...
8: ...e.do?structureId=4e5e RCSB], [https://www.ebi.ac.uk/pdbsum/4e5e PDBsum], [https://prosat.h-its.org/pr... - 4e5f (1,913 bytes)
5: ...(A/Viet_Nam/1203/2004(H5N1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=0N7:2-H...
8: ...e.do?structureId=4e5f RCSB], [https://www.ebi.ac.uk/pdbsum/4e5f PDBsum], [https://prosat.h-its.org/pr... - 4e5g (1,906 bytes)
5: ...(A/Viet_Nam/1203/2004(H5N1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=MN:MANG...
8: ...e.do?structureId=4e5g RCSB], [https://www.ebi.ac.uk/pdbsum/4e5g PDBsum], [https://prosat.h-its.org/pr... - 4e5h (1,957 bytes)
5: ...(A/Viet_Nam/1203/2004(H5N1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1))]. Full crystallographic info...
6: ...mpirical_models|Method:]]</b></td><td class="sblockDat" id="methodDat">X-ray diffraction, [[Resolutio...
7: ...l"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat" id="ligandDat"><scene name='pdbligand=0N8:(2Z...
8: ...e.do?structureId=4e5h RCSB], [https://www.ebi.ac.uk/pdbsum/4e5h PDBsum], [https://prosat.h-its.org/pr...
View (previous 20) (next 20) (20 | 50 | 100 | 250 | 500)