Sandbox Reserved 1547

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Current revision (00:50, 3 May 2019) (edit) (undo)
 
(56 intermediate revisions not shown.)
Line 1: Line 1:
{{ Sandbox_Reserved_GGC_BHCM4100_1}}
{{ Sandbox_Reserved_GGC_BHCM4100_1}}
==Enoyl-coa hydratase complexed with octanoyl-coa==
==Enoyl-coa hydratase complexed with octanoyl-coa==
-
Alternative names: Enoyl hydrase, Unsaturated acyl-CoA hydratase.Cocrystallized with octanoyl-coa.The structure of the hexameric rat mitochondrial enoyl-Coenzyme A (CoA) hydratase, co-crystallised with the inhibitor octanoyl-CoA
+
Alternative names: Crotonase, Enoyl hydrase, Unsaturated acyl-CoA hydratase.Cocrystallized with octanoyl-CoA.The structure of the hexameric rat mitochondrial enoyl-Coenzyme A (CoA) hydratase, co-crystallised with the inhibitor octanoyl-CoA.
 +
<scene name='80/806433/Hetero_components_ligand3/1'>Octanoyl Coenzyme A, four Hetero Components : CO8a, CO8b, CO8c, CO8d</scene>
 +
 
 +
<scene name='80/806433/Co_four/1'>TextToBeDisplayed</scene>
 +
 
The source of the sample from organism: is from mitochondrial Cell of iver of Norway rat, Rattus norvegicus. Organism_taxid: 10116.
The source of the sample from organism: is from mitochondrial Cell of iver of Norway rat, Rattus norvegicus. Organism_taxid: 10116.
-
<StructureSection load='2DUB' size='350' side='right' ='[[2DUB]],[[Resolution|resolution]] 2.40&Aring;' caption='Enoyl-coa hydratase complexed with octanoyl-coa (PDB code [[2DUB]]), pdb|2dub|A B C D E F
+
<StructureSection load='2DUB' size='350' side='right' ='[[2DUB]][[Resolution|resolution]] 2.40&Aring;' caption='Enoyl-coa hydratase complexed with octanoyl-coa (PDB code [[2DUB]])'>
-
GANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH, >'>
+
== Structural Highlights ==
== Structural Highlights ==
 +
<table><tr><td colspan='2'>[[2dub]] is a 6 chain structure with sequence from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2DUB]. Full crystallographic information is available from [http://oca.weizmann.ac.il/oca-bin/ocashort?id=2DUB OCA]. For a <b>guided tour on the structure components</b> use [http://oca.weizmann.ac.il/oca-docs/fgij/fg.htm?mol=2DUB FirstGlance]. <br>
 +
</td></tr><tr id='ligand'><td class="sblockLbl"><b>[[Ligand|Ligands:]]</b></td><td class="sblockDat"><scene name='pdbligand=CO8:OCTANOYL-COENZYME+A'>CO8</scene></td></tr>
 +
<tr id='related'><td class="sblockLbl"><b>[[Related_structure|Related:]]</b></td><td class="sblockDat">[[1DUB|1DUB]], [[1EY3|1EY3]]</td></tr>
 +
<tr id='gene'><td class="sblockLbl"><b>[[Gene|Gene:]]</b></td><td class="sblockDat">2dubA, 2dubB, 2dubC, 2dubD,2dubE, 2dubF ([http://oca.weizmann.ac.il/oca-bin/ocaids])</td></tr>
 +
<tr id='activity'><td class="sblockLbl"><b>[[Activity|Activity:]]</b></td><td class="sblockDat"><span class='plainlinks'>lyase activity enoyl-CoA hydratase activity catalytic activity, with EC number [http://www.brenda-enzymes.info/php/result_flat.php4?ecno=4.2.1.17 4.2.1.17] </span></td></tr>
 +
<tr id='resources'><td class="sblockLbl"><b>Resources:</b></td><td class="sblockDat"><span class='plainlinks'>[http://oca.weizmann.ac.il/oca-bin/ocaids], [http://jenalib.leibniz-fli.de/cgi-bin/3d_mapping.pl?CODE=2dub&MODE=biological1], [https://www.uniprot.org/uniprot/P14604#function]</span></td></tr>
 +
</table>
 +
Length: 261 amino acids, Specific chains of 2-enoyl-coa hydratase are: a, b, c, d, e, f . 6 chain structure with sequence from Rattus norvegicus. ligand: CO8. The catalytic water is bound between Glu144 and Glu164 in the hydratase.
Length: 261 amino acids, Specific chains of 2-enoyl-coa hydratase are: a, b, c, d, e, f . 6 chain structure with sequence from Rattus norvegicus. ligand: CO8. The catalytic water is bound between Glu144 and Glu164 in the hydratase.
 +
<scene name='80/806433/2dub_backbone/1'>Domains in Chains A, B, C, D, E, F </scene>
 +
 +
<scene name='80/806433/Chain_a/2'>Chain A</scene>
 +
 +
<scene name='80/806433/Ligand_close_up/2'>CO8 Pocket Interaction </scene>
 +
 +
== Function ==
== Function ==
-
Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. The chains homologous to 2DUB: 1DUB, 1EY3.
+
MTP catalyzes the last three steps of mitochondrial β-oxidation; LCHAD, long-chain enoyl-CoA hydratase, and long-chain thiolase are all part of the MTP. Short-chain enoyl-CoA hydratase (ECHS1) is a multifunctional mitochondrial matrix enzyme that is involved in the oxidation of fatty acids and essential amino acids such as valine. The MTP is a membrane bound complex and it has 4 alpha and 4 beta sub-unite the gene that codes for our enoyl CoA is found on alpha subunit and is coded by the HADHA gene on chromosome 2p23.3
 +
The active sites of the N- and the C-terminal parts catalyse,respectively, the second (2E-enoyl-CoA hydration) and third (3-hydroxy-acyl-CoA dehydrogenation) reactions
 +
[2] of the b-oxidation pathway of fatty acid metabolism. Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. The chains homologous to 2DUB: 1DUB, 1EY3.
(3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O
(3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O
 +
 +
[[Image:Enoly_CoA_Hyratase.png ]]
 +
 +
== Disease ==
== Disease ==
 +
Mutation of any type like deletion,and or insertion on the HADHA will result in a rare autosomal recessive complete mitochondrial trifunctional protein deficiency, in which all three enzymatic processes do not function properly; more common is LCHAD deficiency, due to a less-encompassing HADHA missense mutation. This deficiency is rare satistics show that in the united States it rages from 1/75,00 to 1/250,000. more most common incidence is recorded in Finland. Clinically, LCHAD deficiency manifests early, typically in the first year of life, with episodes of hypoketotic hypoglycemia accompanied by variable other manifestations, including poor feeding, vomiting, lethargy, hypotonia, hepatic failure, skeletal myopathy and possibly rhabdomyolysis, early-onset cardiomyopathy, sensory polyneuropathy, and sudden death in infancy.
 +
The diagnosis of LCHAD/MTP deficiency may be suspected by elevation of long-chain fatty acyl-CoAs (C14, C16, and C18), especially 16-carbon acyl-CoA (C16), along with elevated urinary dicarboxylic acids.
 +
A catalytic water, bound between the OE1-atoms of the two catalytic glutamates, Glu103 and Glu123, plays an important role in the enoyl-CoA isomerase and the enoyl-CoA hydratase reaction mechanism of MFE1.
Dysfunctional MFE2 is one of the most common reasons of peroxi- somal disorder in humans
Dysfunctional MFE2 is one of the most common reasons of peroxi- somal disorder in humans
== Relevance ==
== Relevance ==
 +
== References ==
 +
http://oca.weizmann.ac.il/oca-bin/ocashort?id=2DUB
-
== Structural highlights ==
+
http://jenalib.leibniz-fli.de/cgi-bin/3d_mapping.pl?CODE=2dub&MODE=biological1
-
This is a sample scene created with SAT to <scene name="/12/3456/Sample/1">color</scene> by Group, and another to make <scene name="/12/3456/Sample/2">a transparent representation</scene> of the protein. You can make your own scenes on SAT starting from scratch or loading and editing one of these sample scenes.
+
https://www.uniprot.org/uniprot/P14604#function
-
</StructureSection>
+
https://www.sciencedirect.com/topics/medicine-and-dentistry/enoyl-coenzyme-a-hydratase
-
== References ==
+
Huaning Zhang, Huaning Zhang, et al. “Fatty Acid Biosynthesis and Oxidation.” ScienceDirect, Elsevier, 17 Mar. 2010, www.sciencedirect.com/science/article/pii/B9780080453828006687.
-
<references/>
+

Current revision

This Sandbox is Reserved from May 28 through July 01, 2019 for use in the course Advanced Biochemistry BCHM 4100 taught by Tom Gluick at the Georgia Gwinnett College. This reservation includes Sandbox Reserved 1544 through Sandbox Reserved 1555.
To get started:
  • Click the edit this page tab at the top. Save the page after each step, then edit it again.
  • Click the 3D button (when editing, above the wikitext box) to insert Jmol.
  • show the Scene authoring tools, create a molecular scene, and save it. Copy the green link into the page.
  • Add a description of your scene. Use the buttons above the wikitext box for bold, italics, links, headlines, etc.

More help: Help:Editing

Enoyl-coa hydratase complexed with octanoyl-coa

Alternative names: Crotonase, Enoyl hydrase, Unsaturated acyl-CoA hydratase.Cocrystallized with octanoyl-CoA.The structure of the hexameric rat mitochondrial enoyl-Coenzyme A (CoA) hydratase, co-crystallised with the inhibitor octanoyl-CoA.

The source of the sample from organism: is from mitochondrial Cell of iver of Norway rat, Rattus norvegicus. Organism_taxid: 10116.

Enoyl-coa hydratase complexed with octanoyl-coa (PDB code 2DUB)

Drag the structure with the mouse to rotate
Personal tools