This old version of Proteopedia is provided for student assignments while the new version is undergoing repairs. Content and edits done in this old version of Proteopedia after March 1, 2026 will eventually be lost when it is retired in about June of 2026.


Apply for new accounts at the new Proteopedia. Your logins will work in both the old and new versions.


Sandbox Reserved 1547

From Proteopedia

(Difference between revisions)
Jump to: navigation, search
Line 3: Line 3:
Alternative names: Enoyl hydrase, Unsaturated acyl-CoA hydratase.Cocrystallized with octanoyl-coa.The structure of the hexameric rat mitochondrial enoyl-Coenzyme A (CoA) hydratase, co-crystallised with the inhibitor octanoyl-CoA
Alternative names: Enoyl hydrase, Unsaturated acyl-CoA hydratase.Cocrystallized with octanoyl-coa.The structure of the hexameric rat mitochondrial enoyl-Coenzyme A (CoA) hydratase, co-crystallised with the inhibitor octanoyl-CoA
The source of the sample from organism: is from mitochondrial Cell of iver of Norway rat, Rattus norvegicus. Organism_taxid: 10116.
The source of the sample from organism: is from mitochondrial Cell of iver of Norway rat, Rattus norvegicus. Organism_taxid: 10116.
-
<StructureSection load='2DUB' size='350' side='right' ='[[2DUB]], [[Resolution|resolution]] 2.40&Aring;' caption='Enoyl-coa hydratase complexed with octanoyl-coa (PDB code [[2DUB]]) '> >2DUB:A|PDBID|CHAIN|SEQUENCE
+
<StructureSection load='2DUB' size='350' side='right' ='[[2DUB]], [[Resolution|resolution]] 2.40&Aring;' caption='Enoyl-coa hydratase complexed with octanoyl-coa (PDB code [[2DUB]]) '>2DUB:A|PDBID|CHAIN|SEQUENCE
GANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQ
GANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQ
DCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAM
DCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAM

Revision as of 21:25, 23 April 2019

This Sandbox is Reserved from May 28 through July 01, 2019 for use in the course Advanced Biochemistry BCHM 4100 taught by Tom Gluick at the Georgia Gwinnett College. This reservation includes Sandbox Reserved 1544 through Sandbox Reserved 1555.
To get started:
  • Click the edit this page tab at the top. Save the page after each step, then edit it again.
  • Click the 3D button (when editing, above the wikitext box) to insert Jmol.
  • show the Scene authoring tools, create a molecular scene, and save it. Copy the green link into the page.
  • Add a description of your scene. Use the buttons above the wikitext box for bold, italics, links, headlines, etc.

More help: Help:Editing

Enoyl-coa hydratase complexed with octanoyl-coa

Alternative names: Enoyl hydrase, Unsaturated acyl-CoA hydratase.Cocrystallized with octanoyl-coa.The structure of the hexameric rat mitochondrial enoyl-Coenzyme A (CoA) hydratase, co-crystallised with the inhibitor octanoyl-CoA The source of the sample from organism: is from mitochondrial Cell of iver of Norway rat, Rattus norvegicus. Organism_taxid: 10116.

Enoyl-coa hydratase complexed with octanoyl-coa (PDB code 2DUB)

Drag the structure with the mouse to rotate

References

Personal tools