User contributions

From Proteopedia

proteopedia linkproteopedia link

Search for contributions

 Show contributions of new accounts only
 IP Address or username: Namespace: all (Main) Talk User User talk Proteopedia Proteopedia talk Image Image talk MediaWiki MediaWiki talk Template Template talk Help Help talk Category Category talk Journal Journal talk Tutorial Tutorial talk Group Group talk Studio Studio talk Book Book talk Mutation Mutation talk Art Art talk BASIL BASIL talk

From year (and earlier): From month (and earlier): all January February March April May June July August September October November December

(Newest | Oldest) View (Newer 50) (Older 50) (20 | 50 | 100 | 250 | 500)

• 21:31, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/NA/MSA‎
• 21:31, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/NA/MSA‎
• 21:29, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/NA/MSA‎
• 21:08, 15 May 2009 (hist) (diff) Image:MSNA1.pdb‎ (top)
• 20:57, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/HA/MSA‎ (top)
• 20:52, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/HA/MSA‎
• 20:50, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/HA/MSA‎
• 20:49, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/HA/MSA‎
• 20:20, 15 May 2009 (hist) (diff) Image:MSHA2.pdb‎ (top)
• 20:17, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PA/MSA‎ (top)
• 20:10, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PA/MSA‎
• 20:09, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PA/MSA‎
• 19:54, 15 May 2009 (hist) (diff) Image:MSPA1.pdb‎ (PA MX homology model) (top)
• 19:49, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB2/MSA‎ (top)
• 19:45, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB2/MSA‎
• 19:06, 15 May 2009 (hist) (diff) Image:MPB21.pdb‎ (top)
• 18:57, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB2/MSA‎
• 18:57, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB2/MSA‎
• 18:34, 15 May 2009 (hist) (diff) Image:PB2 MX model1.pdb‎ (top)
• 18:24, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/NS2/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment of NS2 Protein, 53 sequences== {| class="wikitable" |Protein |Polymorphism |Strain with Polymorphism |Number of Strains with Polymorphism |--...)
• 18:21, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/MP1/MSA‎ (top)
• 18:21, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/NS1/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment of NS1 Protein, 53 sequences== {| class="wikitable" |Protein |Polymorphism |Strain with Polymorphism |Number of Strains with Polymorphism |--...)
• 18:17, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/MP2/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment of MP2 Protein, 64 sequences== {| class="wikitable" |Protein |Polymorphism |Strain with Polymorphism |Number of Strains with Polymorphism |--...)
• 18:13, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/MP1/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment of MP1 Protein, 64 sequences== {| class="wikitable" |MP1 |L3P |gi|227831763_A/California/05/2 |1 |---- |MP1 |H222R |gi|237624333_A/swine/Albe...)
• 18:09, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/NA/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment of NA Protein, 70 sequences== {| class="wikitable" |Protein |Polymorphism |Strain with Polymorphism |Number of Strains with Polymorphism |---...)
• 18:04, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/NP/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment of NP Protein, 67 sequences== {| class="wikitable" |Protein |Polymorphism |Strain with Polymorphism |Number of Strains with Polymorphism |---...)
• 18:00, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/HA/MSA‎
• 17:58, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PA/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment of PA Protein, 42 sequences== {| class="wikitable" |Protein |Polymorphism |Strain with Polymorphism |Number of Strains with Polymorphism |---...)
• 17:54, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB1/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment of PB1 Protein, 39 sequences== {| class="wikitable" |Protein |Polymorphism |Strain with Polymorphism |Number of Strains with Polymorphism |-...) (top)
• 17:51, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB2/MSA‎
• 17:50, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB2/MSA‎
• 17:49, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB2/MSA‎
• 17:46, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB2/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment of PB2 Protein, 31 sequences== <pre> gi|229892698_A/Canada-NS/RV153 MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM 50 gi|237511929_...)
• 17:43, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/HA/MSA‎
• 17:41, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/HA/MSA‎ (New page: == H1N1 Swine Flu Multiple Sequence Alignment == <pre> gi|229396357_A/New_York/12/200 MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLL 50 gi|229892708_A/Canada-AB/RV153 MKAIL...)
• 17:39, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/HA‎
• 17:33, 15 May 2009 (hist) (diff) User:Michael Strong/H1N1/HA‎
• 23:04, 14 May 2009 (hist) (diff) User:Michael Strong/H1N1/PB2‎
• 20:35, 12 May 2009 (hist) (diff) User:Michael Strong‎
• 15:16, 11 May 2009 (hist) (diff) User:Michael Strong‎
• 15:10, 8 May 2009 (hist) (diff) User:Michael Strong/H1N1‎
• 04:45, 8 May 2009 (hist) (diff) User:Michael Strong‎
• 04:38, 8 May 2009 (hist) (diff) User:Michael Strong/H1N1‎
• 04:29, 8 May 2009 (hist) (diff) User:Michael Strong/H1N1‎
• 04:21, 8 May 2009 (hist) (diff) Image:NS m1.pdb‎ (NS_model1.pdb) (top)
• 04:15, 8 May 2009 (hist) (diff) User:Michael Strong/H1N1‎
• 04:05, 8 May 2009 (hist) (diff) User:Michael Strong/H1N1‎
• 03:46, 8 May 2009 (hist) (diff) Image:NS model1.pdb‎ (top)
• 03:03, 8 May 2009 (hist) (diff) User:Michael Strong/H1N1/NP‎
• 23:11, 7 May 2009 (hist) (diff) User:Michael Strong‎

(Newest | Oldest) View (Newer 50) (Older 50) (20 | 50 | 100 | 250 | 500)